PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010931444.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 366aa    MW: 41167.3 Da    PI: 7.0111
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010931444.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.34.1e-55151421129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     l+pGfrFhPtdee++++yL +kv + ++ + +++ evd++k+ePwdLp+++k +ekewyfF+++d+ky+tg r+nrat++gyWkatgkdke+++ 
  XP_010931444.1  15 LAPGFRFHPTDEEIITHYLLEKVMNPSFIA-RAVGEVDLNKCEPWDLPSRAKMGEKEWYFFCQKDRKYPTGVRTNRATEAGYWKATGKDKEIYRG 108
                     579**********************99877.88***************99999****************************************** PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     kg lvg+kktLvfy+grapkgekt+Wvmhe+rle
  XP_010931444.1 109 KGILVGMKKTLVFYRGRAPKGEKTNWVMHEFRLE 142
                     *******************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-6412167IPR003441NAC domain
PROSITE profilePS5100559.54915166IPR003441NAC domain
PfamPF023652.0E-2817141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MGEVSVLAEE ERMDLAPGFR FHPTDEEIIT HYLLEKVMNP SFIARAVGEV DLNKCEPWDL  60
PSRAKMGEKE WYFFCQKDRK YPTGVRTNRA TEAGYWKATG KDKEIYRGKG ILVGMKKTLV  120
FYRGRAPKGE KTNWVMHEFR LEGRTQYHNL QRTSKDEWVV CRVFHKNIGI KRSSMAELVR  180
RNSFGDGIMD SLIDPSYFSS NNRPSSSYVT AGDGGSFRGI STSNNLMPSN LTMLGLEDPQ  240
YNSLMTNGFP NTYNQESTPI NFPRIPPQDP HVLLPGSSNL GYLHQEQAIT KTLSGANDVS  300
NGLKGTCKVE QLSNSVASQD TGLSHDMNTE TSSAISKHEM EGYRFYDLDG LLAAGPVQDL  360
DSLLKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-521216717169NAC domain-containing protein 19
3swp_C5e-521216717169NAC domain-containing protein 19
3swp_B5e-521216717169NAC domain-containing protein 19
3swp_A5e-521216717169NAC domain-containing protein 19
3swm_D5e-521216717169NAC domain-containing protein 19
3swm_C5e-521216717169NAC domain-containing protein 19
3swm_B5e-521216717169NAC domain-containing protein 19
3swm_A5e-521216717169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010931444.10.0PREDICTED: NAC domain-containing protein 100-like
TrEMBLA0A0M4FBT51e-132A0A0M4FBT5_MANES; NAC transcription factors 78
STRINGGSMUA_Achr6P08600_0011e-131(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-100NAC domain containing protein 100